PNC-27 is a hybrid polypeptide 32 amino acids in length with the amino acid sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG that is derived from residues 12-26 of the HDM-2 binding domain of the human tumor-suppressing protein p53, linked to a fragment of membrane residency peptide (MRP).
The compounds of every Wikipedia article carrying a Chembox or a Drugbox, refreshed daily, with the values their infoboxes give. The pages need JavaScript; the API does not.